Anti OPA1 pAb (ATL-HPA036926)

Atlas Antibodies

Catalog No.:
ATL-HPA036926-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: optic atrophy 1 (autosomal dominant)
Gene Name: OPA1
Alternative Gene Name: FLJ12460, KIAA0567, MGM1, NPG, NTG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038084: 95%, ENSRNOG00000001717: 95%
Entrez Gene ID: 4976
Uniprot ID: O60313
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNE
Gene Sequence ESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNELEKMLKCNE
Gene ID - Mouse ENSMUSG00000038084
Gene ID - Rat ENSRNOG00000001717
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OPA1 pAb (ATL-HPA036926)
Datasheet Anti OPA1 pAb (ATL-HPA036926) Datasheet (External Link)
Vendor Page Anti OPA1 pAb (ATL-HPA036926) at Atlas Antibodies

Documents & Links for Anti OPA1 pAb (ATL-HPA036926)
Datasheet Anti OPA1 pAb (ATL-HPA036926) Datasheet (External Link)
Vendor Page Anti OPA1 pAb (ATL-HPA036926)
Citations for Anti OPA1 pAb (ATL-HPA036926) – 1 Found
Bertola, Nadia; Degan, Paolo; Cappelli, Enrico; Ravera, Silvia. Mutated FANCA Gene Role in the Modulation of Energy Metabolism and Mitochondrial Dynamics in Head and Neck Squamous Cell Carcinoma. Cells. 2022;11(15)  PubMed