Anti OLIG2 pAb (ATL-HPA003254 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003254-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: oligodendrocyte lineage transcription factor 2
Gene Name: OLIG2
Alternative Gene Name: BHLHB1, bHLHe19, OLIGO2, PRKCBP2, RACK17
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039830: 93%, ENSRNOG00000028658: 94%
Entrez Gene ID: 10215
Uniprot ID: Q13516
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI
Gene Sequence SPEPDDLFLPARSKGSSGSAFTGGTVSSSTPSDCPPELSAELRGAMGSAGAHPGDKLGGSGFKSSSSSTSSSTSSAAASSTKKDKKQMTEPELQQLRLKINSRERKRMHDLNI
Gene ID - Mouse ENSMUSG00000039830
Gene ID - Rat ENSRNOG00000028658
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OLIG2 pAb (ATL-HPA003254 w/enhanced validation)
Datasheet Anti OLIG2 pAb (ATL-HPA003254 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OLIG2 pAb (ATL-HPA003254 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti OLIG2 pAb (ATL-HPA003254 w/enhanced validation)
Datasheet Anti OLIG2 pAb (ATL-HPA003254 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti OLIG2 pAb (ATL-HPA003254 w/enhanced validation)
Citations for Anti OLIG2 pAb (ATL-HPA003254 w/enhanced validation) – 7 Found
Falcão, Ana Mendanha; van Bruggen, David; Marques, Sueli; Meijer, Mandy; Jäkel, Sarah; Agirre, Eneritz; Samudyata; Floriddia, Elisa M; Vanichkina, Darya P; Ffrench-Constant, Charles; Williams, Anna; Guerreiro-Cacais, André Ortlieb; Castelo-Branco, Gonçalo. Disease-specific oligodendrocyte lineage cells arise in multiple sclerosis. Nature Medicine. 2018;24(12):1837-1844.  PubMed
Jäkel, Sarah; Agirre, Eneritz; Mendanha Falcão, Ana; van Bruggen, David; Lee, Ka Wai; Knuesel, Irene; Malhotra, Dheeraj; Ffrench-Constant, Charles; Williams, Anna; Castelo-Branco, Gonçalo. Altered human oligodendrocyte heterogeneity in multiple sclerosis. Nature. 2019;566(7745):543-547.  PubMed
Larrouquère, Louis; Berthier, Sylvie; Chovelon, Benoit; Garrel, Catherine; Vacchina, Véronique; Paucot, Hugues; Boutonnat, Jean; Faure, Patrice; Hazane-Puch, Florence. Preclinical Evaluation of Sodium Selenite in Mice: Toxicological and Tumor Regression Studies after Striatum Implantation of Human Glioblastoma Stem Cells. International Journal Of Molecular Sciences. 2021;22(19)  PubMed
Saberi, Aref; Aldenkamp, Albert P; Kurniawan, Nicholas A; Bouten, Carlijn V C. In-vitro engineered human cerebral tissues mimic pathological circuit disturbances in 3D. Communications Biology. 2022;5(1):254.  PubMed
Mathys, Hansruedi; Davila-Velderrain, Jose; Peng, Zhuyu; Gao, Fan; Mohammadi, Shahin; Young, Jennie Z; Menon, Madhvi; He, Liang; Abdurrob, Fatema; Jiang, Xueqiao; Martorell, Anthony J; Ransohoff, Richard M; Hafler, Brian P; Bennett, David A; Kellis, Manolis; Tsai, Li-Huei. Single-cell transcriptomic analysis of Alzheimer's disease. Nature. 2019;570(7761):332-337.  PubMed
Macchi, Magali; Magalon, Karine; Zimmer, Céline; Peeva, Elitsa; El Waly, Bilal; Brousse, Béatrice; Jaekel, Sarah; Grobe, Kay; Kiefer, Friedemann; Williams, Anna; Cayre, Myriam; Durbec, Pascale. Mature oligodendrocytes bordering lesions limit demyelination and favor myelin repair via heparan sulfate production. Elife. 2020;9( 32515730)  PubMed
van Erp, Susan; van Berkel, Annemiek A; Feenstra, Eline M; Sahoo, Pabitra K; Wagstaff, Laura J; Twiss, Jeffery L; Fawcett, James W; Eva, Richard; Ffrench-Constant, Charles. Age-related loss of axonal regeneration is reflected by the level of local translation. Experimental Neurology. 2021;339( 33450233):113594.  PubMed