Anti OLFML3 pAb (ATL-HPA027991)

Atlas Antibodies

Catalog No.:
ATL-HPA027991-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: olfactomedin like 3
Gene Name: OLFML3
Alternative Gene Name: HNOEL-iso, OLF44
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027848: 96%, ENSRNOG00000019211: 97%
Entrez Gene ID: 56944
Uniprot ID: Q9NRN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNE
Gene Sequence LVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNE
Gene ID - Mouse ENSMUSG00000027848
Gene ID - Rat ENSRNOG00000019211
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti OLFML3 pAb (ATL-HPA027991)
Datasheet Anti OLFML3 pAb (ATL-HPA027991) Datasheet (External Link)
Vendor Page Anti OLFML3 pAb (ATL-HPA027991) at Atlas Antibodies

Documents & Links for Anti OLFML3 pAb (ATL-HPA027991)
Datasheet Anti OLFML3 pAb (ATL-HPA027991) Datasheet (External Link)
Vendor Page Anti OLFML3 pAb (ATL-HPA027991)