Anti OLA1 pAb (ATL-HPA035790 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035790-25

Protein Description: Obg-like ATPase 1
Gene Name: OLA1
Alternative Gene Name: GTPBP9, PTD004
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027108: 100%, ENSRNOG00000019047: 99%
Entrez Gene ID: 29789
Uniprot ID: Q9NTK5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFED
• Gene Sequence: LTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFED
• Gene ID - Mouse: ENSMUSG00000027108
• Gene ID - Rat: ENSRNOG00000019047
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti OLA1 pAb (ATL-HPA035790 w/enhanced validation) – 4 Found

Bai, Li; Yu, Zubin; Zhang, Jiawei; Yuan, Shuai; Liao, Chen; Jeyabal, Prince V S; Rubio, Valentina; Chen, Huarong; Li, Yafei; Shi, Zheng-Zheng. OLA1 contributes to epithelial-mesenchymal transition in lung cancer by modulating the GSK3β/snail/E-cadherin signaling. Oncotarget. 2016;7(9):10402-13. 

Ding, Zonghui; Liu, Yue; Rubio, Valentina; He, Jinjie; Minze, Laurie J; Shi, Zheng-Zheng. OLA1, a Translational Regulator of p21, Maintains Optimal Cell Proliferation Necessary for Developmental Progression. Molecular And Cellular Biology. 2016;36(20):2568-82. 

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Lu, Senxu; Han, Li; Hu, Xiaoyun; Sun, Tong; Xu, Dongping; Li, Yalun; Chen, Qiuchen; Yao, Weifan; He, Miao; Wang, Zhenning; Wu, Huizhe; Wei, Minjie. N6-methyladenosine reader IMP2 stabilizes the ZFAS1/OLA1 axis and activates the Warburg effect: implication in colorectal cancer. Journal Of Hematology & Oncology. 2021;14(1):188.