Anti OAF pAb (ATL-HPA047412)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047412-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: OAF
Alternative Gene Name: MGC52117
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032014: 87%, ENSRNOG00000009243: 83%
Entrez Gene ID: 220323
Uniprot ID: Q86UD1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RFWLEQGVDSSVFEALPKASEQAELPRCRQVGDRGKPCVCHYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQ |
| Gene Sequence | RFWLEQGVDSSVFEALPKASEQAELPRCRQVGDRGKPCVCHYGLSLAWYPCMLKYCHSRDRPTPYKCGIRSCQKSYSFDFYVPQ |
| Gene ID - Mouse | ENSMUSG00000032014 |
| Gene ID - Rat | ENSRNOG00000009243 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti OAF pAb (ATL-HPA047412) | |
| Datasheet | Anti OAF pAb (ATL-HPA047412) Datasheet (External Link) |
| Vendor Page | Anti OAF pAb (ATL-HPA047412) at Atlas Antibodies |
| Documents & Links for Anti OAF pAb (ATL-HPA047412) | |
| Datasheet | Anti OAF pAb (ATL-HPA047412) Datasheet (External Link) |
| Vendor Page | Anti OAF pAb (ATL-HPA047412) |