Anti NWD2 pAb (ATL-HPA046911)

Atlas Antibodies

Catalog No.:
ATL-HPA046911-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NACHT and WD repeat domain containing 2
Gene Name: NWD2
Alternative Gene Name: KIAA1239
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090061: 96%, ENSRNOG00000051837: 94%
Entrez Gene ID: 57495
Uniprot ID: Q9ULI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DQPWVFQCNPLEPDIFFVNHRKMSELLYHLTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDIELAYNYSQEKELKFLANTLRSIKNKVTAFP
Gene Sequence DQPWVFQCNPLEPDIFFVNHRKMSELLYHLTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDIELAYNYSQEKELKFLANTLRSIKNKVTAFP
Gene ID - Mouse ENSMUSG00000090061
Gene ID - Rat ENSRNOG00000051837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NWD2 pAb (ATL-HPA046911)
Datasheet Anti NWD2 pAb (ATL-HPA046911) Datasheet (External Link)
Vendor Page Anti NWD2 pAb (ATL-HPA046911) at Atlas Antibodies

Documents & Links for Anti NWD2 pAb (ATL-HPA046911)
Datasheet Anti NWD2 pAb (ATL-HPA046911) Datasheet (External Link)
Vendor Page Anti NWD2 pAb (ATL-HPA046911)