Anti NWD2 pAb (ATL-HPA046911)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046911-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NWD2
Alternative Gene Name: KIAA1239
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000090061: 96%, ENSRNOG00000051837: 94%
Entrez Gene ID: 57495
Uniprot ID: Q9ULI1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DQPWVFQCNPLEPDIFFVNHRKMSELLYHLTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDIELAYNYSQEKELKFLANTLRSIKNKVTAFP |
| Gene Sequence | DQPWVFQCNPLEPDIFFVNHRKMSELLYHLTRCGKTDDLLYGIIMNFSWLYTMIKIGQFDKVLSDIELAYNYSQEKELKFLANTLRSIKNKVTAFP |
| Gene ID - Mouse | ENSMUSG00000090061 |
| Gene ID - Rat | ENSRNOG00000051837 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NWD2 pAb (ATL-HPA046911) | |
| Datasheet | Anti NWD2 pAb (ATL-HPA046911) Datasheet (External Link) |
| Vendor Page | Anti NWD2 pAb (ATL-HPA046911) at Atlas Antibodies |
| Documents & Links for Anti NWD2 pAb (ATL-HPA046911) | |
| Datasheet | Anti NWD2 pAb (ATL-HPA046911) Datasheet (External Link) |
| Vendor Page | Anti NWD2 pAb (ATL-HPA046911) |