Anti NUS1 pAb (ATL-HPA027504)

Atlas Antibodies

Catalog No.: ATL-HPA027504-25

Protein Description: nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae)
Gene Name: NUS1
Alternative Gene Name: C6orf68, MGC7199, NgBR, TANGO14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023068: 94%, ENSRNOG00000000411: 90%
Entrez Gene ID: 116150
Uniprot ID: Q96E22
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
• Gene Sequence: ASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
• Gene ID - Mouse: ENSMUSG00000023068
• Gene ID - Rat: ENSRNOG00000000411
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.