Anti NUP214 pAb (ATL-HPA048789)

Atlas Antibodies

Catalog No.:
ATL-HPA048789-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nucleoporin 214kDa
Gene Name: NUP214
Alternative Gene Name: CAIN, CAN, D9S46E, N214
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001855: 83%, ENSRNOG00000047244: 85%
Entrez Gene ID: 8021
Uniprot ID: P35658
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEY
Gene Sequence FDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEY
Gene ID - Mouse ENSMUSG00000001855
Gene ID - Rat ENSRNOG00000047244
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUP214 pAb (ATL-HPA048789)
Datasheet Anti NUP214 pAb (ATL-HPA048789) Datasheet (External Link)
Vendor Page Anti NUP214 pAb (ATL-HPA048789) at Atlas Antibodies

Documents & Links for Anti NUP214 pAb (ATL-HPA048789)
Datasheet Anti NUP214 pAb (ATL-HPA048789) Datasheet (External Link)
Vendor Page Anti NUP214 pAb (ATL-HPA048789)