Anti NUP214 pAb (ATL-HPA048789)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048789-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: NUP214
Alternative Gene Name: CAIN, CAN, D9S46E, N214
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001855: 83%, ENSRNOG00000047244: 85%
Entrez Gene ID: 8021
Uniprot ID: P35658
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEY |
Gene Sequence | FDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEY |
Gene ID - Mouse | ENSMUSG00000001855 |
Gene ID - Rat | ENSRNOG00000047244 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NUP214 pAb (ATL-HPA048789) | |
Datasheet | Anti NUP214 pAb (ATL-HPA048789) Datasheet (External Link) |
Vendor Page | Anti NUP214 pAb (ATL-HPA048789) at Atlas Antibodies |
Documents & Links for Anti NUP214 pAb (ATL-HPA048789) | |
Datasheet | Anti NUP214 pAb (ATL-HPA048789) Datasheet (External Link) |
Vendor Page | Anti NUP214 pAb (ATL-HPA048789) |