Anti NUP214 pAb (ATL-HPA048789)

Atlas Antibodies

Catalog No.: ATL-HPA048789-25

Protein Description: nucleoporin 214kDa
Gene Name: NUP214
Alternative Gene Name: CAIN, CAN, D9S46E, N214
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001855: 83%, ENSRNOG00000047244: 85%
Entrez Gene ID: 8021
Uniprot ID: P35658
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEY
• Gene Sequence: FDSPEELPKERSSLLAVSNKYGLVFAGGASGLQIFPTKNLLIQNKPGDDPNKIVDKVQGLLVPMKFPIHHLALSCDNLTLSACMMSSEY
• Gene ID - Mouse: ENSMUSG00000001855
• Gene ID - Rat: ENSRNOG00000047244
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.