Anti NUMA1 pAb (ATL-HPA019841 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019841-100

Protein Description: nuclear mitotic apparatus protein 1
Gene Name: NUMA1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000066306: 87%, ENSRNOG00000000417: 87%
Entrez Gene ID: 4926
Uniprot ID: Q14980
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IRFLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKEL
• Gene Sequence: IRFLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKEL
• Gene ID - Mouse: ENSMUSG00000066306
• Gene ID - Rat: ENSRNOG00000000417
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.