Anti NUDT9 pAb (ATL-HPA044866)

Atlas Antibodies

Catalog No.: ATL-HPA044866-25

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 9
Gene Name: NUDT9
Alternative Gene Name: MGC3037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029310: 95%, ENSRNOG00000002186: 95%
Entrez Gene ID: 53343
Uniprot ID: Q9BW91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHL
• Gene Sequence: PVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHL
• Gene ID - Mouse: ENSMUSG00000029310
• Gene ID - Rat: ENSRNOG00000002186
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.