Anti NUDT9 pAb (ATL-HPA044866)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044866-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NUDT9
Alternative Gene Name: MGC3037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029310: 95%, ENSRNOG00000002186: 95%
Entrez Gene ID: 53343
Uniprot ID: Q9BW91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHL |
| Gene Sequence | PVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHL |
| Gene ID - Mouse | ENSMUSG00000029310 |
| Gene ID - Rat | ENSRNOG00000002186 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NUDT9 pAb (ATL-HPA044866) | |
| Datasheet | Anti NUDT9 pAb (ATL-HPA044866) Datasheet (External Link) |
| Vendor Page | Anti NUDT9 pAb (ATL-HPA044866) at Atlas Antibodies |
| Documents & Links for Anti NUDT9 pAb (ATL-HPA044866) | |
| Datasheet | Anti NUDT9 pAb (ATL-HPA044866) Datasheet (External Link) |
| Vendor Page | Anti NUDT9 pAb (ATL-HPA044866) |