Anti NUDT9 pAb (ATL-HPA044866)

Atlas Antibodies

Catalog No.:
ATL-HPA044866-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 9
Gene Name: NUDT9
Alternative Gene Name: MGC3037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029310: 95%, ENSRNOG00000002186: 95%
Entrez Gene ID: 53343
Uniprot ID: Q9BW91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHL
Gene Sequence PVSGKHILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKTSAEKREIEEKLHKLFSQDHL
Gene ID - Mouse ENSMUSG00000029310
Gene ID - Rat ENSRNOG00000002186
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUDT9 pAb (ATL-HPA044866)
Datasheet Anti NUDT9 pAb (ATL-HPA044866) Datasheet (External Link)
Vendor Page Anti NUDT9 pAb (ATL-HPA044866) at Atlas Antibodies

Documents & Links for Anti NUDT9 pAb (ATL-HPA044866)
Datasheet Anti NUDT9 pAb (ATL-HPA044866) Datasheet (External Link)
Vendor Page Anti NUDT9 pAb (ATL-HPA044866)