Anti NUDT8 pAb (ATL-HPA041252)

Atlas Antibodies

Catalog No.:
ATL-HPA041252-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 8
Gene Name: NUDT8
Alternative Gene Name: FLJ41567
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110949: 57%, ENSRNOG00000017955: 56%
Entrez Gene ID: 254552
Uniprot ID: Q8WV74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVFALPLAHLLQTQNQGYTHFCRGGHFRYTLPVFLHGPHRVWGLTAVITEFALQLLAPGTYQPRLAGLTCSGAEGLARPKQPLASPCQASSTPGLNKGL
Gene Sequence EVFALPLAHLLQTQNQGYTHFCRGGHFRYTLPVFLHGPHRVWGLTAVITEFALQLLAPGTYQPRLAGLTCSGAEGLARPKQPLASPCQASSTPGLNKGL
Gene ID - Mouse ENSMUSG00000110949
Gene ID - Rat ENSRNOG00000017955
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUDT8 pAb (ATL-HPA041252)
Datasheet Anti NUDT8 pAb (ATL-HPA041252) Datasheet (External Link)
Vendor Page Anti NUDT8 pAb (ATL-HPA041252) at Atlas Antibodies

Documents & Links for Anti NUDT8 pAb (ATL-HPA041252)
Datasheet Anti NUDT8 pAb (ATL-HPA041252) Datasheet (External Link)
Vendor Page Anti NUDT8 pAb (ATL-HPA041252)