Anti NUDT7 pAb (ATL-HPA042042)

Atlas Antibodies

Catalog No.: ATL-HPA042042-25

Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 7
Gene Name: NUDT7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031767: 73%, ENSRNOG00000011976: 68%
Entrez Gene ID: 283927
Uniprot ID: P0C024
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTD
• Gene Sequence: MSRLGLPEEPVRNSLLDDAKARLRKYDIGGKYSHLPYNKYSVLLPLVAKEGKLHLLFTVRSEKLRRAPGEVCFPGGKRDPTD
• Gene ID - Mouse: ENSMUSG00000031767
• Gene ID - Rat: ENSRNOG00000011976
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.