Anti NUDT12 pAb (ATL-HPA045449)

Atlas Antibodies

Catalog No.:
ATL-HPA045449-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: nudix (nucleoside diphosphate linked moiety X)-type motif 12
Gene Name: NUDT12
Alternative Gene Name: DKFZP761I172
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024228: 96%, ENSRNOG00000022576: 95%
Entrez Gene ID: 83594
Uniprot ID: Q9BQG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIA
Gene Sequence VRREVEEESGVKVGHVQYVACQPWPMPSSLMIGCLALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFFVPPSRAIA
Gene ID - Mouse ENSMUSG00000024228
Gene ID - Rat ENSRNOG00000022576
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NUDT12 pAb (ATL-HPA045449)
Datasheet Anti NUDT12 pAb (ATL-HPA045449) Datasheet (External Link)
Vendor Page Anti NUDT12 pAb (ATL-HPA045449) at Atlas Antibodies

Documents & Links for Anti NUDT12 pAb (ATL-HPA045449)
Datasheet Anti NUDT12 pAb (ATL-HPA045449) Datasheet (External Link)
Vendor Page Anti NUDT12 pAb (ATL-HPA045449)