Anti NUBP1 pAb (ATL-HPA041656 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041656-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NUBP1
Alternative Gene Name: NBP1, NBP35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022503: 89%, ENSRNOG00000002574: 89%
Entrez Gene ID: 4682
Uniprot ID: P53384
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVEN |
| Gene Sequence | TSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVEN |
| Gene ID - Mouse | ENSMUSG00000022503 |
| Gene ID - Rat | ENSRNOG00000002574 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NUBP1 pAb (ATL-HPA041656 w/enhanced validation) | |
| Datasheet | Anti NUBP1 pAb (ATL-HPA041656 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NUBP1 pAb (ATL-HPA041656 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NUBP1 pAb (ATL-HPA041656 w/enhanced validation) | |
| Datasheet | Anti NUBP1 pAb (ATL-HPA041656 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NUBP1 pAb (ATL-HPA041656 w/enhanced validation) |
| Citations for Anti NUBP1 pAb (ATL-HPA041656 w/enhanced validation) – 2 Found |
| Ferecatu, Ioana; Canal, Frédéric; Fabbri, Lucilla; Mazure, Nathalie M; Bouton, Cécile; Golinelli-Cohen, Marie-Pierre. Dysfunction in the mitochondrial Fe-S assembly machinery leads to formation of the chemoresistant truncated VDAC1 isoform without HIF-1α activation. Plos One. 13(3):e0194782. PubMed |
| Ferecatu, Ioana; Gonçalves, Sergio; Golinelli-Cohen, Marie-Pierre; Clémancey, Martin; Martelli, Alain; Riquier, Sylvie; Guittet, Eric; Latour, Jean-Marc; Puccio, Hélène; Drapier, Jean-Claude; Lescop, Ewen; Bouton, Cécile. The diabetes drug target MitoNEET governs a novel trafficking pathway to rebuild an Fe-S cluster into cytosolic aconitase/iron regulatory protein 1. The Journal Of Biological Chemistry. 2014;289(41):28070-86. PubMed |