Anti NUAK2 pAb (ATL-HPA008958)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008958-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NUAK2
Alternative Gene Name: FLJ90349, SNARK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009772: 81%, ENSRNOG00000000034: 81%
Entrez Gene ID: 81788
Uniprot ID: Q9H093
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT |
| Gene Sequence | DPKEQKPPQASGLLLHRKGILKLNGKFSQTALELAAPTTFGSLDELAPPRPLARASRPSGAVSEDSILSSESFDQLDLPERLPEPPLRGCVSVDNLTGLEEPPSEGPGSCLRRWRQDPLGDSCFSLTDCQEVTATYRQALRVCSKLT |
| Gene ID - Mouse | ENSMUSG00000009772 |
| Gene ID - Rat | ENSRNOG00000000034 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NUAK2 pAb (ATL-HPA008958) | |
| Datasheet | Anti NUAK2 pAb (ATL-HPA008958) Datasheet (External Link) |
| Vendor Page | Anti NUAK2 pAb (ATL-HPA008958) at Atlas Antibodies |
| Documents & Links for Anti NUAK2 pAb (ATL-HPA008958) | |
| Datasheet | Anti NUAK2 pAb (ATL-HPA008958) Datasheet (External Link) |
| Vendor Page | Anti NUAK2 pAb (ATL-HPA008958) |
| Citations for Anti NUAK2 pAb (ATL-HPA008958) – 1 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |