Anti NTS pAb (ATL-HPA026664 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026664-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NTS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019890: 72%, ENSRNOG00000004179: 70%
Entrez Gene ID: 4922
Uniprot ID: P30990
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DFLTNMHTSKLIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRP |
| Gene Sequence | DFLTNMHTSKLIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRP |
| Gene ID - Mouse | ENSMUSG00000019890 |
| Gene ID - Rat | ENSRNOG00000004179 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NTS pAb (ATL-HPA026664 w/enhanced validation) | |
| Datasheet | Anti NTS pAb (ATL-HPA026664 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NTS pAb (ATL-HPA026664 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti NTS pAb (ATL-HPA026664 w/enhanced validation) | |
| Datasheet | Anti NTS pAb (ATL-HPA026664 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti NTS pAb (ATL-HPA026664 w/enhanced validation) |