Anti NTRK3 pAb (ATL-HPA048065)

Atlas Antibodies

Catalog No.:
ATL-HPA048065-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: neurotrophic tyrosine kinase, receptor, type 3
Gene Name: NTRK3
Alternative Gene Name: TRKC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059146: 100%, ENSRNOG00000018674: 100%
Entrez Gene ID: 4916
Uniprot ID: Q16288
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCI
Gene Sequence DGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCI
Gene ID - Mouse ENSMUSG00000059146
Gene ID - Rat ENSRNOG00000018674
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NTRK3 pAb (ATL-HPA048065)
Datasheet Anti NTRK3 pAb (ATL-HPA048065) Datasheet (External Link)
Vendor Page Anti NTRK3 pAb (ATL-HPA048065) at Atlas Antibodies

Documents & Links for Anti NTRK3 pAb (ATL-HPA048065)
Datasheet Anti NTRK3 pAb (ATL-HPA048065) Datasheet (External Link)
Vendor Page Anti NTRK3 pAb (ATL-HPA048065)