Anti NTF3 pAb (ATL-HPA032001)
Atlas Antibodies
- Catalog No.:
- ATL-HPA032001-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NTF3
Alternative Gene Name: NGF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049107: 86%, ENSRNOG00000019716: 87%
Entrez Gene ID: 4908
Uniprot ID: P20783
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NMDQRRLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDT |
| Gene Sequence | NMDQRRLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDT |
| Gene ID - Mouse | ENSMUSG00000049107 |
| Gene ID - Rat | ENSRNOG00000019716 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NTF3 pAb (ATL-HPA032001) | |
| Datasheet | Anti NTF3 pAb (ATL-HPA032001) Datasheet (External Link) |
| Vendor Page | Anti NTF3 pAb (ATL-HPA032001) at Atlas Antibodies |
| Documents & Links for Anti NTF3 pAb (ATL-HPA032001) | |
| Datasheet | Anti NTF3 pAb (ATL-HPA032001) Datasheet (External Link) |
| Vendor Page | Anti NTF3 pAb (ATL-HPA032001) |