Anti NTF3 pAb (ATL-HPA032001)

Atlas Antibodies

Catalog No.:
ATL-HPA032001-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: neurotrophin 3
Gene Name: NTF3
Alternative Gene Name: NGF2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049107: 86%, ENSRNOG00000019716: 87%
Entrez Gene ID: 4908
Uniprot ID: P20783
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NMDQRRLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDT
Gene Sequence NMDQRRLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQSTLPKAEAPREPERGGPAKSAFQPVIAMDT
Gene ID - Mouse ENSMUSG00000049107
Gene ID - Rat ENSRNOG00000019716
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NTF3 pAb (ATL-HPA032001)
Datasheet Anti NTF3 pAb (ATL-HPA032001) Datasheet (External Link)
Vendor Page Anti NTF3 pAb (ATL-HPA032001) at Atlas Antibodies

Documents & Links for Anti NTF3 pAb (ATL-HPA032001)
Datasheet Anti NTF3 pAb (ATL-HPA032001) Datasheet (External Link)
Vendor Page Anti NTF3 pAb (ATL-HPA032001)