Anti NT5E pAb (ATL-HPA017357)

Atlas Antibodies

Catalog No.:
ATL-HPA017357-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: 5'-nucleotidase, ecto (CD73)
Gene Name: NT5E
Alternative Gene Name: CALJA, CD73, eN, eNT, NT5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032420: 90%, ENSRNOG00000011071: 92%
Entrez Gene ID: 4907
Uniprot ID: P21589
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
Gene Sequence EFDNGVEGLIEPLLKEAKFPILSANIKAKGPLASQISGLYLPYKVLPVGDEVVGIVGYTSKETPFLSNPGTNLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQK
Gene ID - Mouse ENSMUSG00000032420
Gene ID - Rat ENSRNOG00000011071
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NT5E pAb (ATL-HPA017357)
Datasheet Anti NT5E pAb (ATL-HPA017357) Datasheet (External Link)
Vendor Page Anti NT5E pAb (ATL-HPA017357) at Atlas Antibodies

Documents & Links for Anti NT5E pAb (ATL-HPA017357)
Datasheet Anti NT5E pAb (ATL-HPA017357) Datasheet (External Link)
Vendor Page Anti NT5E pAb (ATL-HPA017357)
Citations for Anti NT5E pAb (ATL-HPA017357) – 5 Found
Haun, Randy S; Quick, Charles M; Siegel, Eric R; Raju, Ilangovan; Mackintosh, Samuel G; Tackett, Alan J. Bioorthogonal labeling cell-surface proteins expressed in pancreatic cancer cells to identify potential diagnostic/therapeutic biomarkers. Cancer Biology & Therapy. 16(10):1557-65.  PubMed
Magagna, Ilaria; Gourdin, Nicolas; Kieffer, Yann; Licaj, Monika; Mhaidly, Rana; Andre, Pascale; Morel, Ariane; Vincent-Salomon, Anne; Paturel, Carine; Mechta-Grigoriou, Fatima. CD73-Mediated Immunosuppression Is Linked to a Specific Fibroblast Population That Paves the Way for New Therapy in Breast Cancer. Cancers. 2021;13(23)  PubMed
Serra, Sara; Horenstein, Alberto L; Vaisitti, Tiziana; Brusa, Davide; Rossi, Davide; Laurenti, Luca; D'Arena, Giovanni; Coscia, Marta; Tripodo, Claudio; Inghirami, Giorgio; Robson, Simon C; Gaidano, Gianluca; Malavasi, Fabio; Deaglio, Silvia. CD73-generated extracellular adenosine in chronic lymphocytic leukemia creates local conditions counteracting drug-induced cell death. Blood. 2011;118(23):6141-52.  PubMed
Alcedo, Karel P; Guerrero, Andres; Basrur, Venkatesha; Fu, Dong; Richardson, Monea L; McLane, Joshua S; Tsou, Chih-Chiang; Nesvizhskii, Alexey I; Welling, Theodore H; Lebrilla, Carlito B; Otey, Carol A; Kim, Hong Jin; Omary, M Bishr; Snider, Natasha T. Tumor-Selective Altered Glycosylation and Functional Attenuation of CD73 in Human Hepatocellular Carcinoma. Hepatology Communications. 2019;3(10):1400-1414.  PubMed
Chen, Yen-Hao; Lu, Hung-I; Lo, Chien-Ming; Li, Shau-Hsuan. CD73 Promotes Tumor Progression in Patients with Esophageal Squamous Cell Carcinoma. Cancers. 2021;13(16)  PubMed