Anti NSUN5 pAb (ATL-HPA045590)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045590-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NSUN5
Alternative Gene Name: FLJ10267, NOL1R, NSUN5A, p120(NOL1), WBSCR20, WBSCR20A, Ynl022cL
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 55695
Uniprot ID: Q96P11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRL |
| Gene Sequence | MPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRL |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NSUN5 pAb (ATL-HPA045590) | |
| Datasheet | Anti NSUN5 pAb (ATL-HPA045590) Datasheet (External Link) |
| Vendor Page | Anti NSUN5 pAb (ATL-HPA045590) at Atlas Antibodies |
| Documents & Links for Anti NSUN5 pAb (ATL-HPA045590) | |
| Datasheet | Anti NSUN5 pAb (ATL-HPA045590) Datasheet (External Link) |
| Vendor Page | Anti NSUN5 pAb (ATL-HPA045590) |