Anti NSUN5 pAb (ATL-HPA045590)

Atlas Antibodies

Catalog No.:
ATL-HPA045590-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: NOP2/Sun domain family, member 5
Gene Name: NSUN5
Alternative Gene Name: FLJ10267, NOL1R, NSUN5A, p120(NOL1), WBSCR20, WBSCR20A, Ynl022cL
Isotype: IgG
Interspecies mouse/rat: ,
Entrez Gene ID: 55695
Uniprot ID: Q96P11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRL
Gene Sequence MPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRL
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NSUN5 pAb (ATL-HPA045590)
Datasheet Anti NSUN5 pAb (ATL-HPA045590) Datasheet (External Link)
Vendor Page Anti NSUN5 pAb (ATL-HPA045590) at Atlas Antibodies

Documents & Links for Anti NSUN5 pAb (ATL-HPA045590)
Datasheet Anti NSUN5 pAb (ATL-HPA045590) Datasheet (External Link)
Vendor Page Anti NSUN5 pAb (ATL-HPA045590)