Anti NSMCE4A pAb (ATL-HPA044872)

Atlas Antibodies

Catalog No.: ATL-HPA044872-25

Protein Description: NSE4 homolog A, SMC5-SMC6 complex component
Gene Name: NSMCE4A
Alternative Gene Name: bA500G22.3, C10orf86, FLJ20003, NSE4A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040331: 88%, ENSRNOG00000020452: 90%
Entrez Gene ID: 54780
Uniprot ID: Q9NXX6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLDAHFLVLASDLGKEKAKQLRSDLSSFDMLRYVETLLTHMGVNPLEAEELIRDEDSPDFEFIVYDSWKITGRTAENT
• Gene Sequence: VLDAHFLVLASDLGKEKAKQLRSDLSSFDMLRYVETLLTHMGVNPLEAEELIRDEDSPDFEFIVYDSWKITGRTAENT
• Gene ID - Mouse: ENSMUSG00000040331
• Gene ID - Rat: ENSRNOG00000020452
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.