Anti NRP2 pAb (ATL-HPA039980)

Atlas Antibodies

Catalog No.:
ATL-HPA039980-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: neuropilin 2
Gene Name: NRP2
Alternative Gene Name: VEGF165R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025969: 96%, ENSRNOG00000031232: 95%
Entrez Gene ID: 8828
Uniprot ID: O60462
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYL
Gene Sequence LSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYL
Gene ID - Mouse ENSMUSG00000025969
Gene ID - Rat ENSRNOG00000031232
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NRP2 pAb (ATL-HPA039980)
Datasheet Anti NRP2 pAb (ATL-HPA039980) Datasheet (External Link)
Vendor Page Anti NRP2 pAb (ATL-HPA039980) at Atlas Antibodies

Documents & Links for Anti NRP2 pAb (ATL-HPA039980)
Datasheet Anti NRP2 pAb (ATL-HPA039980) Datasheet (External Link)
Vendor Page Anti NRP2 pAb (ATL-HPA039980)
Citations for Anti NRP2 pAb (ATL-HPA039980) – 2 Found
Vasquez, Evalynn; Cristofaro, Vivian; Lukianov, Stefan; Burkhard, Fiona C; Gheinani, Ali Hashemi; Monastyrskaya, Katia; Bielenberg, Diane R; Sullivan, Maryrose P; Adam, Rosalyn M. Deletion of neuropilin 2 enhances detrusor contractility following bladder outlet obstruction. Jci Insight. 2017;2(3):e90617.  PubMed
Islam, Ridwan; Mishra, Juhi; Polavaram, Navatha Shree; Bhattacharya, Sreyashi; Hong, Zhengdong; Bodas, Sanika; Sharma, Sunandini; Bouska, Alyssa; Gilbreath, Tyler; Said, Ahmed M; Smith, Lynette M; Teply, Benjamin A; Muders, Michael H; Batra, Surinder K; Datta, Kaustubh; Dutta, Samikshan. Neuropilin-2 axis in regulating secretory phenotype of neuroendocrine-like prostate cancer cells and its implication in therapy resistance. Cell Reports. 2022;40(3):111097.  PubMed