Anti NRP2 pAb (ATL-HPA039980)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039980-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NRP2
Alternative Gene Name: VEGF165R2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025969: 96%, ENSRNOG00000031232: 95%
Entrez Gene ID: 8828
Uniprot ID: O60462
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYL |
| Gene Sequence | LSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYSDGRWTPQQSRLHGDDNGWTPNLDSNKEYL |
| Gene ID - Mouse | ENSMUSG00000025969 |
| Gene ID - Rat | ENSRNOG00000031232 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NRP2 pAb (ATL-HPA039980) | |
| Datasheet | Anti NRP2 pAb (ATL-HPA039980) Datasheet (External Link) |
| Vendor Page | Anti NRP2 pAb (ATL-HPA039980) at Atlas Antibodies |
| Documents & Links for Anti NRP2 pAb (ATL-HPA039980) | |
| Datasheet | Anti NRP2 pAb (ATL-HPA039980) Datasheet (External Link) |
| Vendor Page | Anti NRP2 pAb (ATL-HPA039980) |
| Citations for Anti NRP2 pAb (ATL-HPA039980) – 2 Found |
| Vasquez, Evalynn; Cristofaro, Vivian; Lukianov, Stefan; Burkhard, Fiona C; Gheinani, Ali Hashemi; Monastyrskaya, Katia; Bielenberg, Diane R; Sullivan, Maryrose P; Adam, Rosalyn M. Deletion of neuropilin 2 enhances detrusor contractility following bladder outlet obstruction. Jci Insight. 2017;2(3):e90617. PubMed |
| Islam, Ridwan; Mishra, Juhi; Polavaram, Navatha Shree; Bhattacharya, Sreyashi; Hong, Zhengdong; Bodas, Sanika; Sharma, Sunandini; Bouska, Alyssa; Gilbreath, Tyler; Said, Ahmed M; Smith, Lynette M; Teply, Benjamin A; Muders, Michael H; Batra, Surinder K; Datta, Kaustubh; Dutta, Samikshan. Neuropilin-2 axis in regulating secretory phenotype of neuroendocrine-like prostate cancer cells and its implication in therapy resistance. Cell Reports. 2022;40(3):111097. PubMed |