Anti NRP1 pAb (ATL-HPA030278)

Atlas Antibodies

Catalog No.: ATL-HPA030278-25

Protein Description: neuropilin 1
Gene Name: NRP1
Alternative Gene Name: CD304, NRP, VEGF165R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025810: 97%, ENSRNOG00000010744: 92%
Entrez Gene ID: 8829
Uniprot ID: O14786
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGE
• Gene Sequence: EGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGE
• Gene ID - Mouse: ENSMUSG00000025810
• Gene ID - Rat: ENSRNOG00000010744
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NRP1 pAb (ATL-HPA030278) – 4 Found

Wang, Ying; Cao, Ying; Mangalam, Ashutosh K; Guo, Yong; LaFrance-Corey, Reghann G; Gamez, Jeffrey D; Atanga, Pascal Aliihnui; Clarkson, Benjamin D; Zhang, Yuebo; Wang, Enfeng; Angom, Ramcharan Singh; Dutta, Kirthica; Ji, Baoan; Pirko, Istvan; Lucchinetti, Claudia F; Howe, Charles L; Mukhopadhyay, Debabrata. Neuropilin-1 modulates interferon-γ-stimulated signaling in brain microvascular endothelial cells. Journal Of Cell Science. 2016;129(20):3911-3921. 

Venkova, Kalina; Christov, Alexander; Kamaluddin, Zarine; Kobalka, Peter; Siddiqui, Saaid; Hensley, Kenneth. Semaphorin 3A signaling through neuropilin-1 is an early trigger for distal axonopathy in the SOD1G93A mouse model of amyotrophic lateral sclerosis. Journal Of Neuropathology And Experimental Neurology. 2014;73(7):702-13. 

Tang, Yu Hin; Rockstroh, Anja; Sokolowski, Kamil A; Lynam, Layla-Rose; Lehman, Melanie; Thompson, Erik W; Gregory, Philip A; Nelson, Colleen C; Volpert, Marianna; Hollier, Brett G. Neuropilin-1 is over-expressed in claudin-low breast cancer and promotes tumor progression through acquisition of stem cell characteristics and RAS/MAPK pathway activation. Breast Cancer Research : Bcr. 2022;24(1):8. 

Stocker, Nino; Radzikowska, Urszula; Wawrzyniak, Paulina; Tan, Ge; Huang, Mengting; Ding, Mei; Akdis, Cezmi A; Sokolowska, Milena. Regulation of angiotensin-converting enzyme 2 isoforms by type 2 inflammation and viral infection in human airway epithelium. Mucosal Immunology. 2023;16(1):5-16.