Anti NRIP1 pAb (ATL-HPA046571)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046571-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: NRIP1
Alternative Gene Name: RIP140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048490: 79%, ENSRNOG00000001585: 80%
Entrez Gene ID: 8204
Uniprot ID: P48552
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ |
Gene Sequence | SSEAHLQQYSREHALKTQNANQAASERLAAMARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNAGYKNSLERNNIKQ |
Gene ID - Mouse | ENSMUSG00000048490 |
Gene ID - Rat | ENSRNOG00000001585 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti NRIP1 pAb (ATL-HPA046571) | |
Datasheet | Anti NRIP1 pAb (ATL-HPA046571) Datasheet (External Link) |
Vendor Page | Anti NRIP1 pAb (ATL-HPA046571) at Atlas Antibodies |
Documents & Links for Anti NRIP1 pAb (ATL-HPA046571) | |
Datasheet | Anti NRIP1 pAb (ATL-HPA046571) Datasheet (External Link) |
Vendor Page | Anti NRIP1 pAb (ATL-HPA046571) |
Citations for Anti NRIP1 pAb (ATL-HPA046571) – 1 Found |
Sixou, Sophie; Müller, Katharina; Jalaguier, Stéphan; Kuhn, Christina; Harbeck, Nadia; Mayr, Doris; Engel, Jutta; Jeschke, Udo; Ditsch, Nina; Cavaillès, Vincent. Importance of RIP140 and LCoR Sub-Cellular Localization for Their Association With Breast Cancer Aggressiveness and Patient Survival. Translational Oncology. 2018;11(5):1090-1096. PubMed |