Anti NR4A2 pAb (ATL-HPA000543)

Atlas Antibodies

Catalog No.:
ATL-HPA000543-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: nuclear receptor subfamily 4, group A, member 2
Gene Name: NR4A2
Alternative Gene Name: HZF-3, NOT, NURR1, RNR1, TINUR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026826: 100%, ENSRNOG00000005600: 100%
Entrez Gene ID: 4929
Uniprot ID: P43354
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP
Gene Sequence VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP
Gene ID - Mouse ENSMUSG00000026826
Gene ID - Rat ENSRNOG00000005600
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NR4A2 pAb (ATL-HPA000543)
Datasheet Anti NR4A2 pAb (ATL-HPA000543) Datasheet (External Link)
Vendor Page Anti NR4A2 pAb (ATL-HPA000543) at Atlas Antibodies

Documents & Links for Anti NR4A2 pAb (ATL-HPA000543)
Datasheet Anti NR4A2 pAb (ATL-HPA000543) Datasheet (External Link)
Vendor Page Anti NR4A2 pAb (ATL-HPA000543)
Citations for Anti NR4A2 pAb (ATL-HPA000543) – 3 Found
Noro, Erika; Yokoyama, Atsushi; Kobayashi, Makoto; Shimada, Hiroki; Suzuki, Susumu; Hosokawa, Mari; Takehara, Tomohiro; Parvin, Rehana; Shima, Hiroki; Igarashi, Kazuhiko; Sugawara, Akira. Endogenous Purification of NR4A2 (Nurr1) Identified Poly(ADP-Ribose) Polymerase 1 as a Prime Coregulator in Human Adrenocortical H295R Cells. International Journal Of Molecular Sciences. 2018;19(5)  PubMed
Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.  PubMed
Aiden, Aviva Presser; Rivera, Miguel N; Rheinbay, Esther; Ku, Manching; Coffman, Erik J; Truong, Thanh T; Vargas, Sara O; Lander, Eric S; Haber, Daniel A; Bernstein, Bradley E. Wilms tumor chromatin profiles highlight stem cell properties and a renal developmental network. Cell Stem Cell. 2010;6(6):591-602.  PubMed