Anti NR4A2 pAb (ATL-HPA000543)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000543-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: NR4A2
Alternative Gene Name: HZF-3, NOT, NURR1, RNR1, TINUR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026826: 100%, ENSRNOG00000005600: 100%
Entrez Gene ID: 4929
Uniprot ID: P43354
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP |
| Gene Sequence | VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP |
| Gene ID - Mouse | ENSMUSG00000026826 |
| Gene ID - Rat | ENSRNOG00000005600 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NR4A2 pAb (ATL-HPA000543) | |
| Datasheet | Anti NR4A2 pAb (ATL-HPA000543) Datasheet (External Link) |
| Vendor Page | Anti NR4A2 pAb (ATL-HPA000543) at Atlas Antibodies |
| Documents & Links for Anti NR4A2 pAb (ATL-HPA000543) | |
| Datasheet | Anti NR4A2 pAb (ATL-HPA000543) Datasheet (External Link) |
| Vendor Page | Anti NR4A2 pAb (ATL-HPA000543) |
| Citations for Anti NR4A2 pAb (ATL-HPA000543) – 3 Found |
| Noro, Erika; Yokoyama, Atsushi; Kobayashi, Makoto; Shimada, Hiroki; Suzuki, Susumu; Hosokawa, Mari; Takehara, Tomohiro; Parvin, Rehana; Shima, Hiroki; Igarashi, Kazuhiko; Sugawara, Akira. Endogenous Purification of NR4A2 (Nurr1) Identified Poly(ADP-Ribose) Polymerase 1 as a Prime Coregulator in Human Adrenocortical H295R Cells. International Journal Of Molecular Sciences. 2018;19(5) PubMed |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |
| Aiden, Aviva Presser; Rivera, Miguel N; Rheinbay, Esther; Ku, Manching; Coffman, Erik J; Truong, Thanh T; Vargas, Sara O; Lander, Eric S; Haber, Daniel A; Bernstein, Bradley E. Wilms tumor chromatin profiles highlight stem cell properties and a renal developmental network. Cell Stem Cell. 2010;6(6):591-602. PubMed |