Anti NR1H3 pAb (ATL-HPA036443)

Atlas Antibodies

Catalog No.: ATL-HPA036443-25

Protein Description: nuclear receptor subfamily 1, group H, member 3
Gene Name: NR1H3
Alternative Gene Name: LXR-a, RLD-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002108: 68%, ENSRNOG00000013172: 68%
Entrez Gene ID: 10062
Uniprot ID: Q13133
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRK
• Gene Sequence: MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRAEPPSEPTEIRPQKRK
• Gene ID - Mouse: ENSMUSG00000002108
• Gene ID - Rat: ENSRNOG00000013172
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.