Anti NQO1 pAb (ATL-HPA007308 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007308-25

Protein Description: NAD(P)H dehydrogenase, quinone 1
Gene Name: NQO1
Alternative Gene Name: DHQU, DIA4, DTD, NMOR1, QR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003849: 88%, ENSRNOG00000012772: 85%
Entrez Gene ID: 1728
Uniprot ID: P15559
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
• Gene Sequence: FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR
• Gene ID - Mouse: ENSMUSG00000003849
• Gene ID - Rat: ENSRNOG00000012772
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NQO1 pAb (ATL-HPA007308 w/enhanced validation) – 18 Found

Shelton, Luke M; Lister, Adam; Walsh, Joanne; Jenkins, Rosalind E; Wong, Michael H L; Rowe, Cliff; Ricci, Emanuele; Ressel, Lorenzo; Fang, Yongxiang; Demougin, Philippe; Vukojevic, Vanja; O'Neill, Paul M; Goldring, Christopher E; Kitteringham, Neil R; Park, B Kevin; Odermatt, Alex; Copple, Ian M. Integrated transcriptomic and proteomic analyses uncover regulatory roles of Nrf2 in the kidney. Kidney International. 2015;88(6):1261-1273. 

DeNicola, Gina M; Chen, Pei-Hsuan; Mullarky, Edouard; Sudderth, Jessica A; Hu, Zeping; Wu, David; Tang, Hao; Xie, Yang; Asara, John M; Huffman, Kenneth E; Wistuba, Ignacio I; Minna, John D; DeBerardinis, Ralph J; Cantley, Lewis C. NRF2 regulates serine biosynthesis in non-small cell lung cancer. Nature Genetics. 2015;47(12):1475-81. 

Fiorillo, Marco; Sotgia, Federica; Sisci, Diego; Cappello, Anna Rita; Lisanti, Michael P. Mitochondrial "power" drives tamoxifen resistance: NQO1 and GCLC are new therapeutic targets in breast cancer. Oncotarget. 2017;8(12):20309-20327. 

Kang, Yun Pyo; Torrente, Laura; Falzone, Aimee; Elkins, Cody M; Liu, Min; Asara, John M; Dibble, Christian C; DeNicola, Gina M. Cysteine dioxygenase 1 is a metabolic liability for non-small cell lung cancer. Elife. 2019;8( 31107239) 

Purohit, Vinee; Wang, Lidong; Yang, Huibin; Li, Jiufeng; Ney, Gina M; Gumkowski, Erica R; Vaidya, Akash J; Wang, Annie; Bhardwaj, Amit; Zhao, Ende; Dolgalev, Igor; Zamperone, Andrea; Abel, Ethan V; Magliano, Marina Pasca Di; Crawford, Howard C; Diolaiti, Daniel; Papagiannakopoulos, Thales Y; Lyssiotis, Costas A; Simeone, Diane M. ATDC binds to KEAP1 to drive NRF2-mediated tumorigenesis and chemoresistance in pancreatic cancer. Genes & Development. 2021;35(3-4):218-233. 

Romero, Rodrigo; Sánchez-Rivera, Francisco J; Westcott, Peter M K; Mercer, Kim L; Bhutkar, Arjun; Muir, Alexander; González Robles, Tania J; Lamboy Rodríguez, Swanny; Liao, Laura Z; Ng, Sheng Rong; Li, Leanne; Colón, Caterina I; Naranjo, Santiago; Beytagh, Mary Clare; Lewis, Caroline A; Hsu, Peggy P; Bronson, Roderick T; Vander Heiden, Matthew G; Jacks, Tyler. Keap1 mutation renders lung adenocarcinomas dependent on Slc33a1. Nature Cancer. 2020;1(6):589-602. 

Ding, Hongyu; Chen, Zihong; Wu, Katherine; Huang, Shih Ming; Wu, Warren L; LeBoeuf, Sarah E; Pillai, Ray G; Rabinowitz, Joshua D; Papagiannakopoulos, Thales. Activation of the NRF2 antioxidant program sensitizes tumors to G6PD inhibition. Science Advances. 2021;7(47):eabk1023. 

Jiang, Chang; Ward, Nathan P; Prieto-Farigua, Nicolas; Kang, Yun Pyo; Thalakola, Anish; Teng, Mingxiang; DeNicola, Gina M. A CRISPR screen identifies redox vulnerabilities for KEAP1/NRF2 mutant non-small cell lung cancer. Redox Biology. 2022;54( 35667246):102358. 

Heitz, Fabrice D; Erb, Michael; Anklin, Corinne; Robay, Dimitri; Pernet, Vincent; Gueven, Nuri. Idebenone protects against retinal damage and loss of vision in a mouse model of Leber's hereditary optic neuropathy. Plos One. 7(9):e45182. 

Schulze, Kornelius; Imbeaud, Sandrine; Letouzé, Eric; Alexandrov, Ludmil B; Calderaro, Julien; Rebouissou, Sandra; Couchy, Gabrielle; Meiller, Clément; Shinde, Jayendra; Soysouvanh, Frederic; Calatayud, Anna-Line; Pinyol, Roser; Pelletier, Laura; Balabaud, Charles; Laurent, Alexis; Blanc, Jean-Frederic; Mazzaferro, Vincenzo; Calvo, Fabien; Villanueva, Augusto; Nault, Jean-Charles; Bioulac-Sage, Paulette; Stratton, Michael R; Llovet, Josep M; Zucman-Rossi, Jessica. Exome sequencing of hepatocellular carcinomas identifies new mutational signatures and potential therapeutic targets. Nature Genetics. 2015;47(5):505-511. 

Dayton, Talya L; Gocheva, Vasilena; Miller, Kathryn M; Israelsen, William J; Bhutkar, Arjun; Clish, Clary B; Davidson, Shawn M; Luengo, Alba; Bronson, Roderick T; Jacks, Tyler; Vander Heiden, Matthew G. Germline loss of PKM2 promotes metabolic distress and hepatocellular carcinoma. Genes & Development. 2016;30(9):1020-33. 

Beinse, Guillaume; Just, Pierre-Alexandre; Rance, Bastien; Izac, Brigitte; Letourneur, Franck; Saidu, Nathaniel Edward Bennett; Chouzenoux, Sandrine; Nicco, Carole; Goldwasser, François; Pasmant, Eric; Batteux, Frederic; Borghese, Bruno; Alexandre, Jérôme; Leroy, Karen. The NRF2 transcriptional target NQO1 has low mRNA levels in TP53-mutated endometrial carcinomas. Plos One. 14(3):e0214416. 

LeBoeuf, Sarah E; Wu, Warren L; Karakousi, Triantafyllia R; Karadal, Burcu; Jackson, S RaElle; Davidson, Shawn M; Wong, Kwok-Kin; Koralov, Sergei B; Sayin, Volkan I; Papagiannakopoulos, Thales. Activation of Oxidative Stress Response in Cancer Generates a Druggable Dependency on Exogenous Non-essential Amino Acids. Cell Metabolism. 2020;31(2):339-350.e4. 

Torrente, Laura; Prieto-Farigua, Nicolas; Falzone, Aimee; Elkins, Cody M; Boothman, David A; Haura, Eric B; DeNicola, Gina M. Inhibition of TXNRD or SOD1 overcomes NRF2-mediated resistance to β-lapachone. Redox Biology. 2020;30( 32007910):101440. 

Yang, Yun; Zheng, Jie; Wang, Mengchao; Zhang, Jin; Tian, Tao; Wang, Zhiheng; Yuan, Shengxian; Liu, Lei; Zhu, Peng; Gu, Fangming; Fu, Siyuan; Shan, Yunfeng; Pan, Zeya; Zhou, Weiping. NQO1 promotes an aggressive phenotype in hepatocellular carcinoma via amplifying ERK-NRF2 signaling. Cancer Science. 2021;112(2):641-654. 

Tuerdi, Ayinuer; Kikuta, Shu; Kinoshita, Makoto; Kamogashira, Teru; Kondo, Kenji; Yamasoba, Tatsuya. Zone-specific damage of the olfactory epithelium under protein restriction. Scientific Reports. 2020;10(1):22175. 

Ward, Nathan P; Kang, Yun Pyo; Falzone, Aimee; Boyle, Theresa A; DeNicola, Gina M. Nicotinamide nucleotide transhydrogenase regulates mitochondrial metabolism in NSCLC through maintenance of Fe-S protein function. The Journal Of Experimental Medicine. 2020;217(6) 

Asantewaa, Gloria; Tuttle, Emily T; Ward, Nathan P; Kang, Yun Pyo; Kim, Yumi; Kavanagh, Madeline E; Girnius, Nomeda; Chen, Ying; Duncan, Renae; Rodriguez, Katherine; Hecht, Fabio; Zocchi, Marco; Smorodintsev-Schiller, Leonid; Scales, TashJaé Q; Taylor, Kira; Alimohammadi, Fatemeh; Sechrist, Zachary R; Agostini-Vulaj, Diana; Schafer, Xenia L; Chang, Hayley; Smith, Zachary; O'Connor, Thomas N; Whelan, Sarah; Selfors, Laura M; Crowdis, Jett; Gray, G Kenneth; Bronson, Roderick T; Brenner, Dirk; Rufini, Alessandro; Dirksen, Robert T; Hezel, Aram F; Huber, Aaron R; Munger, Josh; Cravatt, Benjamin F; Vasiliou, Vasilis; Cole, Calvin L; DeNicola, Gina M; Harris, Isaac S. Glutathione supports lipid abundance in vivo. Biorxiv : The Preprint Server For Biology. 2023; 36798186( 36798186)