Anti NPY4R pAb (ATL-HPA027863)

Atlas Antibodies

Catalog No.: ATL-HPA027863-25

Protein Description: neuropeptide Y receptor Y4
Gene Name: NPY4R
Alternative Gene Name: PP1, PPYR1, Y4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048337: 69%, ENSRNOG00000061026: 65%
Entrez Gene ID: 5540
Uniprot ID: P50391
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSPRLSGRSN
• Gene Sequence: NTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSPRLSGRSN
• Gene ID - Mouse: ENSMUSG00000048337
• Gene ID - Rat: ENSRNOG00000061026
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NPY4R pAb (ATL-HPA027863) – 1 Found

Guida, Claudia; McCulloch, Laura J; Godazgar, Mahdieh; Stephen, Sam D; Baker, Charlotte; Basco, Davide; Dong, Jiawen; Chen, Duan; Clark, Anne; Ramracheya, Reshma D. Sitagliptin and Roux-en-Y gastric bypass modulate insulin secretion via regulation of intra-islet PYY. Diabetes, Obesity & Metabolism. 2018;20(3):571-581.