Anti NPTXR pAb (ATL-HPA001079 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001079-25

Protein Description: neuronal pentraxin receptor
Gene Name: NPTXR
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022421: 95%, ENSRNOG00000016156: 96%
Entrez Gene ID: 23467
Uniprot ID: O95502
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HHICIAWTTRDGLWSAYQDGELQGSGENLAAWHPIKPHGILILGQEQDTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTAPLLGNVLPWEDKLVEAFGGATKAAFDVC
• Gene Sequence: HHICIAWTTRDGLWSAYQDGELQGSGENLAAWHPIKPHGILILGQEQDTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGIANCTAPLLGNVLPWEDKLVEAFGGATKAAFDVC
• Gene ID - Mouse: ENSMUSG00000022421
• Gene ID - Rat: ENSRNOG00000016156
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NPTXR pAb (ATL-HPA001079 w/enhanced validation) – 2 Found

Remnestål, Julia; Öijerstedt, Linn; Ullgren, Abbe; Olofsson, Jennie; Bergström, Sofia; Kultima, Kim; Ingelsson, Martin; Kilander, Lena; Uhlén, Mathias; Månberg, Anna; Graff, Caroline; Nilsson, Peter. Altered levels of CSF proteins in patients with FTD, presymptomatic mutation carriers and non-carriers. Translational Neurodegeneration. 2020;9(1):27. 

Remnestål, Julia; Bergström, Sofia; Olofsson, Jennie; Sjöstedt, Evelina; Uhlén, Mathias; Blennow, Kaj; Zetterberg, Henrik; Zettergren, Anna; Kern, Silke; Skoog, Ingmar; Nilsson, Peter; Månberg, Anna. Association of CSF proteins with tau and amyloid β levels in asymptomatic 70-year-olds. Alzheimer's Research & Therapy. 2021;13(1):54.