Anti NPRL2 pAb (ATL-HPA038197 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038197-25

Protein Description: nitrogen permease regulator-like 2 (S. cerevisiae)
Gene Name: NPRL2
Alternative Gene Name: NPR2, NPR2L, TUSC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010057: 100%, ENSRNOG00000021660: 100%
Entrez Gene ID: 10641
Uniprot ID: Q8WTW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHVD
• Gene Sequence: YSNVYCPTPKVQDLVDDKSLQEACLSYVTKQGHKRASLRDVFQLYCSLSPGTTVRDLIGRHPQQLQHVD
• Gene ID - Mouse: ENSMUSG00000010057
• Gene ID - Rat: ENSRNOG00000021660
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.