Anti NPHP3 pAb (ATL-HPA009150)
Atlas Antibodies
- Catalog No.:
- ATL-HPA009150-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: NPHP3
Alternative Gene Name: CFAP31, FLJ30691, FLJ36696, KIAA2000, MKS7, NPH3, SLSN3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032558: 90%, ENSRNOG00000048978: 89%
Entrez Gene ID: 27031
Uniprot ID: Q7Z494
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PEFAHSSIDVEGPFANVNRDDWDIAVASLLQVTPLFSHSLWSNTVRCYLIYTDETQPEMDLFLKDYSPKLKRMCETMGYFFHAVYFPIDVENQYLTVRKWEIEKS |
| Gene Sequence | PEFAHSSIDVEGPFANVNRDDWDIAVASLLQVTPLFSHSLWSNTVRCYLIYTDETQPEMDLFLKDYSPKLKRMCETMGYFFHAVYFPIDVENQYLTVRKWEIEKS |
| Gene ID - Mouse | ENSMUSG00000032558 |
| Gene ID - Rat | ENSRNOG00000048978 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NPHP3 pAb (ATL-HPA009150) | |
| Datasheet | Anti NPHP3 pAb (ATL-HPA009150) Datasheet (External Link) |
| Vendor Page | Anti NPHP3 pAb (ATL-HPA009150) at Atlas Antibodies |
| Documents & Links for Anti NPHP3 pAb (ATL-HPA009150) | |
| Datasheet | Anti NPHP3 pAb (ATL-HPA009150) Datasheet (External Link) |
| Vendor Page | Anti NPHP3 pAb (ATL-HPA009150) |
| Citations for Anti NPHP3 pAb (ATL-HPA009150) – 2 Found |
| Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
| Blandin, Gaëlle; Marchand, Sylvie; Charton, Karine; Danièle, Nathalie; Gicquel, Evelyne; Boucheteil, Jean-Baptiste; Bentaib, Azéddine; Barrault, Laetitia; Stockholm, Daniel; Bartoli, Marc; Richard, Isabelle. A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome. Skeletal Muscle. 2013;3(1):3. PubMed |