Anti NOL7 pAb (ATL-HPA049693)

Atlas Antibodies

Catalog No.:
ATL-HPA049693-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: nucleolar protein 7, 27kDa
Gene Name: NOL7
Alternative Gene Name: C6orf90, dJ223E5.2, NOP27, PQBP3, RARG-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063200: 70%, ENSRNOG00000017904: 72%
Entrez Gene ID: 51406
Uniprot ID: Q9UMY1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFL
Gene Sequence SPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFL
Gene ID - Mouse ENSMUSG00000063200
Gene ID - Rat ENSRNOG00000017904
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NOL7 pAb (ATL-HPA049693)
Datasheet Anti NOL7 pAb (ATL-HPA049693) Datasheet (External Link)
Vendor Page Anti NOL7 pAb (ATL-HPA049693) at Atlas Antibodies

Documents & Links for Anti NOL7 pAb (ATL-HPA049693)
Datasheet Anti NOL7 pAb (ATL-HPA049693) Datasheet (External Link)
Vendor Page Anti NOL7 pAb (ATL-HPA049693)