Anti NOL10 pAb (ATL-HPA035286)

Atlas Antibodies

Catalog No.: ATL-HPA035286-100

Protein Description: nucleolar protein 10
Gene Name: NOL10
Alternative Gene Name: FLJ14075, PQBP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061458: 99%, ENSRNOG00000005344: 100%
Entrez Gene ID: 79954
Uniprot ID: Q9BSC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILATGTYKPRVRCYDTYQLSLKFERCL
• Gene Sequence: QVSSLNEVKIYSLSCGKSLPEWLSDRKKRALQKKDVDVRRRIELIQDFEMPTVCTTIKVSKDGQYILATGTYKPRVRCYDTYQLSLKFERCL
• Gene ID - Mouse: ENSMUSG00000061458
• Gene ID - Rat: ENSRNOG00000005344
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.