Anti NMU pAb (ATL-HPA025926)

Atlas Antibodies

Catalog No.:
ATL-HPA025926-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: neuromedin U
Gene Name: NMU
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029236: 76%, ENSRNOG00000002164: 72%
Entrez Gene ID: 10874
Uniprot ID: P48645
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Gene Sequence ILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Gene ID - Mouse ENSMUSG00000029236
Gene ID - Rat ENSRNOG00000002164
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NMU pAb (ATL-HPA025926)
Datasheet Anti NMU pAb (ATL-HPA025926) Datasheet (External Link)
Vendor Page Anti NMU pAb (ATL-HPA025926) at Atlas Antibodies

Documents & Links for Anti NMU pAb (ATL-HPA025926)
Datasheet Anti NMU pAb (ATL-HPA025926) Datasheet (External Link)
Vendor Page Anti NMU pAb (ATL-HPA025926)
Citations for Anti NMU pAb (ATL-HPA025926) – 2 Found
Wang, Lei; Chen, Chen; Li, Fen; Hua, Qing-Quan; Chen, Shiming; Xiao, Bokui; Dai, Mengyuan; Li, Man; Zheng, Anyuan; Yu, Di; Hu, Zhang Wei; Tao, Zezhang. Overexpression of neuromedin U is correlated with regional metastasis of head and neck squamous cell carcinoma. Molecular Medicine Reports. 2016;14(2):1075-82.  PubMed
Garczyk, Stefan; Klotz, Natalie; Szczepanski, Sabrina; Denecke, Bernd; Antonopoulos, Wiebke; von Stillfried, Saskia; Knüchel, Ruth; Rose, Michael; Dahl, Edgar. Oncogenic features of neuromedin U in breast cancer are associated with NMUR2 expression involving crosstalk with members of the WNT signaling pathway. Oncotarget. 2017;8(22):36246-36265.  PubMed