Anti NMU pAb (ATL-HPA025926)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025926-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: NMU
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029236: 76%, ENSRNOG00000002164: 72%
Entrez Gene ID: 10874
Uniprot ID: P48645
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI |
| Gene Sequence | ILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI |
| Gene ID - Mouse | ENSMUSG00000029236 |
| Gene ID - Rat | ENSRNOG00000002164 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NMU pAb (ATL-HPA025926) | |
| Datasheet | Anti NMU pAb (ATL-HPA025926) Datasheet (External Link) |
| Vendor Page | Anti NMU pAb (ATL-HPA025926) at Atlas Antibodies |
| Documents & Links for Anti NMU pAb (ATL-HPA025926) | |
| Datasheet | Anti NMU pAb (ATL-HPA025926) Datasheet (External Link) |
| Vendor Page | Anti NMU pAb (ATL-HPA025926) |
| Citations for Anti NMU pAb (ATL-HPA025926) – 2 Found |
| Wang, Lei; Chen, Chen; Li, Fen; Hua, Qing-Quan; Chen, Shiming; Xiao, Bokui; Dai, Mengyuan; Li, Man; Zheng, Anyuan; Yu, Di; Hu, Zhang Wei; Tao, Zezhang. Overexpression of neuromedin U is correlated with regional metastasis of head and neck squamous cell carcinoma. Molecular Medicine Reports. 2016;14(2):1075-82. PubMed |
| Garczyk, Stefan; Klotz, Natalie; Szczepanski, Sabrina; Denecke, Bernd; Antonopoulos, Wiebke; von Stillfried, Saskia; Knüchel, Ruth; Rose, Michael; Dahl, Edgar. Oncogenic features of neuromedin U in breast cancer are associated with NMUR2 expression involving crosstalk with members of the WNT signaling pathway. Oncotarget. 2017;8(22):36246-36265. PubMed |