Anti NMT2 pAb (ATL-HPA001303 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA001303-25

Protein Description: N-myristoyltransferase 2
Gene Name: NMT2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026643: 94%, ENSRNOG00000026248: 78%
Entrez Gene ID: 9397
Uniprot ID: O60551
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLL
• Gene Sequence: GGTKSDSASDSQEIKIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLL
• Gene ID - Mouse: ENSMUSG00000026643
• Gene ID - Rat: ENSRNOG00000026248
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NMT2 pAb (ATL-HPA001303 w/enhanced validation) – 2 Found

Kallemeijn, Wouter W; Lueg, Gregor A; Faronato, Monica; Hadavizadeh, Kate; Goya Grocin, Andrea; Song, Ok-Ryul; Howell, Michael; Calado, Dinis P; Tate, Edward W. Validation and Invalidation of Chemical Probes for the Human N-myristoyltransferases. Cell Chemical Biology. 2019;26(6):892-900.e4. 

Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22.