Anti NMT1 pAb (ATL-HPA022963 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022963-25

Protein Description: N-myristoyltransferase 1
Gene Name: NMT1
Alternative Gene Name: NMT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020936: 93%, ENSRNOG00000002989: 94%
Entrez Gene ID: 4836
Uniprot ID: P30419
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTH
• Gene Sequence: KGSETDSAQDQPVKMNSLPAERIQEIQKAIELFSVGQGPAKTMEEASKRSYQFWDTQPVPKLGEVVNTH
• Gene ID - Mouse: ENSMUSG00000020936
• Gene ID - Rat: ENSRNOG00000002989
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NMT1 pAb (ATL-HPA022963 w/enhanced validation) – 3 Found

Kallemeijn, Wouter W; Lueg, Gregor A; Faronato, Monica; Hadavizadeh, Kate; Goya Grocin, Andrea; Song, Ok-Ryul; Howell, Michael; Calado, Dinis P; Tate, Edward W. Validation and Invalidation of Chemical Probes for the Human N-myristoyltransferases. Cell Chemical Biology. 2019;26(6):892-900.e4. 

Thinon, Emmanuelle; Serwa, Remigiusz A; Broncel, Malgorzata; Brannigan, James A; Brassat, Ute; Wright, Megan H; Heal, William P; Wilkinson, Anthony J; Mann, David J; Tate, Edward W. Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. Nature Communications. 2014;5( 25255805):4919. 

Thinon, Emmanuelle; Morales-Sanfrutos, Julia; Mann, David J; Tate, Edward W. N-Myristoyltransferase Inhibition Induces ER-Stress, Cell Cycle Arrest, and Apoptosis in Cancer Cells. Acs Chemical Biology. 2016;11(8):2165-76.