Anti NME1 pAb (ATL-HPA008467)

Atlas Antibodies

Catalog No.: ATL-HPA008467-25

Protein Description: NME/NM23 nucleoside diphosphate kinase 1
Gene Name: NME1
Alternative Gene Name: NDPKA, NM23, NM23-H1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091228: 60%, ENSRNOG00000002693: 60%
Entrez Gene ID: 4830
Uniprot ID: P15531
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
• Gene Sequence: MVLLSTLGIVFQGEGPPISSCDTGTMANCERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFMQ
• Gene ID - Mouse: ENSMUSG00000091228
• Gene ID - Rat: ENSRNOG00000002693
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NME1 pAb (ATL-HPA008467) – 2 Found

Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. 

Röwer, Claudia; Ziems, Björn; Radtke, Anngret; Schmitt, Oliver; Reimer, Toralf; Koy, Cornelia; Thiesen, Hans-Jürgen; Gerber, Bernd; Glocker, Michael O. Toponostics of invasive ductal breast carcinoma: combination of spatial protein expression imaging and quantitative proteome signature analysis. International Journal Of Clinical And Experimental Pathology. 2011;4(5):454-67.