Anti NLRP7 pAb (ATL-HPA051382)

Atlas Antibodies

Catalog No.:
ATL-HPA051382-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: NLR family, pyrin domain containing 7
Gene Name: NLRP7
Alternative Gene Name: CLR19.4, NALP7, NOD12, PAN7, PYPAF3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035177: 35%, ENSRNOG00000059733: 33%
Entrez Gene ID: 199713
Uniprot ID: Q8WX94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAK
Gene Sequence LNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENWIRNATVNILEEMNLTELCKMAK
Gene ID - Mouse ENSMUSG00000035177
Gene ID - Rat ENSRNOG00000059733
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NLRP7 pAb (ATL-HPA051382)
Datasheet Anti NLRP7 pAb (ATL-HPA051382) Datasheet (External Link)
Vendor Page Anti NLRP7 pAb (ATL-HPA051382) at Atlas Antibodies

Documents & Links for Anti NLRP7 pAb (ATL-HPA051382)
Datasheet Anti NLRP7 pAb (ATL-HPA051382) Datasheet (External Link)
Vendor Page Anti NLRP7 pAb (ATL-HPA051382)