Anti NLRP3 pAb (ATL-HPA012878)

Atlas Antibodies

Catalog No.: ATL-HPA012878-25

Protein Description: NLR family, pyrin domain containing 3
Gene Name: NLRP3
Alternative Gene Name: AGTAVPRL, AII, AVP, C1orf7, CIAS1, CLR1.1, FCAS, FCU, MWS, NALP3, PYPAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032691: 79%, ENSRNOG00000003170: 78%
Entrez Gene ID: 114548
Uniprot ID: Q96P20
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR
• Gene Sequence: FKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMIDFNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNARVSNPTVICQEDSIEEEWMGLLEYLSRISICKMKKDYRKKYR
• Gene ID - Mouse: ENSMUSG00000032691
• Gene ID - Rat: ENSRNOG00000003170
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NLRP3 pAb (ATL-HPA012878) – 16 Found

L'homme, Laurent; Esser, Nathalie; Riva, Laura; Scheen, André; Paquot, Nicolas; Piette, Jacques; Legrand-Poels, Sylvie. Unsaturated fatty acids prevent activation of NLRP3 inflammasome in human monocytes/macrophages. Journal Of Lipid Research. 2013;54(11):2998-3008. 

Paramel Varghese, Geena; Folkersen, Lasse; Strawbridge, Rona J; Halvorsen, Bente; Yndestad, Arne; Ranheim, Trine; Krohg-Sørensen, Kirsten; Skjelland, Mona; Espevik, Terje; Aukrust, Pål; Lengquist, Mariette; Hedin, Ulf; Jansson, Jan-Håkan; Fransén, Karin; Hansson, Göran K; Eriksson, Per; Sirsjö, Allan. NLRP3 Inflammasome Expression and Activation in Human Atherosclerosis. Journal Of The American Heart Association. 2016;5(5) 

Li, Xuan; Thome, Sarah; Ma, Xiaodan; Amrute-Nayak, Mamta; Finigan, Alison; Kitt, Lauren; Masters, Leanne; James, John R; Shi, Yuguang; Meng, Guoyu; Mallat, Ziad. MARK4 regulates NLRP3 positioning and inflammasome activation through a microtubule-dependent mechanism. Nature Communications. 2017;8( 28656979):15986. 

Kosmidou, Cassandra; Efstathiou, Nikolaos E; Hoang, Mien V; Notomi, Shoji; Konstantinou, Eleni K; Hirano, Masayuki; Takahashi, Kosuke; Maidana, Daniel E; Tsoka, Pavlina; Young, Lucy; Gragoudas, Evangelos S; Olsen, Timothy W; Morizane, Yuki; Miller, Joan W; Vavvas, Demetrios G. Issues with the Specificity of Immunological Reagents for NLRP3: Implications for Age-related Macular Degeneration. Scientific Reports. 2018;8(1):461. 

Abdul-Sater, Ali A; Koo, Evonne; Häcker, Georg; Ojcius, David M. Inflammasome-dependent caspase-1 activation in cervical epithelial cells stimulates growth of the intracellular pathogen Chlamydia trachomatis. The Journal Of Biological Chemistry. 2009;284(39):26789-96. 

Saïd-Sadier, Najwane; Padilla, Eduardo; Langsley, Gordon; Ojcius, David M. Aspergillus fumigatus stimulates the NLRP3 inflammasome through a pathway requiring ROS production and the Syk tyrosine kinase. Plos One. 2010;5(4):e10008. 

Abdul-Sater, Ali A; Saïd-Sadier, Najwane; Padilla, Eduardo V; Ojcius, David M. Chlamydial infection of monocytes stimulates IL-1beta secretion through activation of the NLRP3 inflammasome. Microbes And Infection. 2010;12(8-9):652-661. 

Haneklaus, Moritz; Gerlic, Motti; Kurowska-Stolarska, Mariola; Rainey, Ashleigh-Ann; Pich, Dagmar; McInnes, Iain B; Hammerschmidt, Wolfgang; O'Neill, Luke A J; Masters, Seth L. Cutting edge: miR-223 and EBV miR-BART15 regulate the NLRP3 inflammasome and IL-1β production. Journal Of Immunology (Baltimore, Md. : 1950). 2012;189(8):3795-9. 

Panchanathan, Ravichandran; Liu, Hongzhu; Leung, Yuet-Kin; Ho, Shuk-mei; Choubey, Divaker. Bisphenol A (BPA) stimulates the interferon signaling and activates the inflammasome activity in myeloid cells. Molecular And Cellular Endocrinology. 2015;415( 26277401):45-55. 

Panchanathan, Ravichandran; Liu, Hongzhu; Choubey, Divaker. Hypoxia primes human normal prostate epithelial cells and cancer cell lines for the NLRP3 and AIM2 inflammasome activation. Oncotarget. 2016;7(19):28183-94. 

Hsieh, Heidi; Vignesh, Kavitha Subramanian; Deepe, George S Jr; Choubey, Divaker; Shertzer, Howard G; Genter, Mary Beth. Mechanistic studies of the toxicity of zinc gluconate in the olfactory neuronal cell line Odora. Toxicology In Vitro : An International Journal Published In Association With Bibra. 2016;35( 27179668):24-30. 

Iacobini, Carla; Menini, Stefano; Blasetti Fantauzzi, Claudia; Pesce, Carlo M; Giaccari, Andrea; Salomone, Enrica; Lapolla, Annunziata; Orioli, Marica; Aldini, Giancarlo; Pugliese, Giuseppe. FL-926-16, a novel bioavailable carnosinase-resistant carnosine derivative, prevents onset and stops progression of diabetic nephropathy in db/db mice. British Journal Of Pharmacology. 2018;175(1):53-66. 

Yang, Li; Mizuochi, Tatsuki; Shivakumar, Pranavkumar; Mourya, Reena; Luo, Zhenhua; Gutta, Sridevi; Bezerra, Jorge A. Regulation of epithelial injury and bile duct obstruction by NLRP3, IL-1R1 in experimental biliary atresia. Journal Of Hepatology. 2018;69(5):1136-1144. 

Ershaid, Nour; Sharon, Yoray; Doron, Hila; Raz, Yael; Shani, Ophir; Cohen, Noam; Monteran, Lea; Leider-Trejo, Leonor; Ben-Shmuel, Amir; Yassin, Muhammad; Gerlic, Motti; Ben-Baruch, Adit; Pasmanik-Chor, Metsada; Apte, Roni; Erez, Neta. NLRP3 inflammasome in fibroblasts links tissue damage with inflammation in breast cancer progression and metastasis. Nature Communications. 2019;10(1):4375. 

Wu, Rongrong; Högberg, Johan; Adner, Mikael; Ramos-Ramírez, Patricia; Stenius, Ulla; Zheng, Huiyuan. Crystalline silica particles cause rapid NLRP3-dependent mitochondrial depolarization and DNA damage in airway epithelial cells. Particle And Fibre Toxicology. 2020;17(1):39. 

Gritsenko, Anna; Yu, Shi; Martin-Sanchez, Fatima; Diaz-Del-Olmo, Ines; Nichols, Eva-Maria; Davis, Daniel M; Brough, David; Lopez-Castejon, Gloria. Priming Is Dispensable for NLRP3 Inflammasome Activation in Human Monocytes In Vitro. Frontiers In Immunology. 11( 33101286):565924.