Anti NLN pAb (ATL-HPA031862)

Atlas Antibodies

Catalog No.: ATL-HPA031862-25

Protein Description: neurolysin (metallopeptidase M3 family)
Gene Name: NLN
Alternative Gene Name: AGTBP, KIAA1226
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021710: 84%, ENSRNOG00000011561: 81%
Entrez Gene ID: 57486
Uniprot ID: Q9BYT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRMTLGREVMSPLQAMSSYTVAGRNVLRWDLSPEQIKTRTEELIVQTKQVYDAVGMLGIEEVTYENCL
• Gene Sequence: LRMTLGREVMSPLQAMSSYTVAGRNVLRWDLSPEQIKTRTEELIVQTKQVYDAVGMLGIEEVTYENCL
• Gene ID - Mouse: ENSMUSG00000021710
• Gene ID - Rat: ENSRNOG00000011561
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.