Anti NLK pAb (ATL-HPA018192)

Atlas Antibodies

Catalog No.: ATL-HPA018192-25

Protein Description: nemo-like kinase
Gene Name: NLK
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017376: 100%, ENSRNOG00000008704: 100%
Entrez Gene ID: 51701
Uniprot ID: Q9UBE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPS
• Gene Sequence: LRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPS
• Gene ID - Mouse: ENSMUSG00000017376
• Gene ID - Rat: ENSRNOG00000008704
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NLK pAb (ATL-HPA018192) – 2 Found

Zhang, Bin; Li, Ke Yi; Chen, Hai Ying; Pan, Shao Dong; Chen, Shuang Feng; Zhang, Wei Feng; Xia, Chun Peng; Jiang, Li Cheng; Liu, Xian Bin; Zhao, Feng Jun; Yuan, Dao Ying; Wang, Le Xin; Wu, Ya Ping; Liu, Shu Wei. Lentivirus-based RNA silencing of Nemo-like kinase (NLK) inhibits the CAL 27 human adenosquamos carcinoma cells proliferation and blocks G0/G1 phase to S phase. International Journal Of Medical Sciences. 10(10):1301-6. 

Suwei, Dong; Liang, Zeng; Zhimin, Liu; Ruilei, Li; Yingying, Zou; Zhen, Li; Chunlei, Ge; Zhangchao, Lai; Yuanbo, Xue; Jinyan, Yang; Gaofeng, Li; Xin, Song. NLK functions to maintain proliferation and stemness of NSCLC and is a target of metformin. Journal Of Hematology & Oncology. 2015;8( 26503334):120.