Anti NKX2-3 pAb (ATL-HPA047561)

Atlas Antibodies

SKU:
ATL-HPA047561-25
  • Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: NK2 homeobox 3
Gene Name: NKX2-3
Alternative Gene Name: CSX3, NKX2.3, NKX2C, NKX4-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044220: 82%, ENSRNOG00000016656: 84%
Entrez Gene ID: 159296
Uniprot ID: Q8TAU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPR
Gene Sequence DEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPR
Gene ID - Mouse ENSMUSG00000044220
Gene ID - Rat ENSRNOG00000016656
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti NKX2-3 pAb (ATL-HPA047561)
Datasheet Anti NKX2-3 pAb (ATL-HPA047561) Datasheet (External Link)
Vendor Page Anti NKX2-3 pAb (ATL-HPA047561) at Atlas Antibodies

Documents & Links for Anti NKX2-3 pAb (ATL-HPA047561)
Datasheet Anti NKX2-3 pAb (ATL-HPA047561) Datasheet (External Link)
Vendor Page Anti NKX2-3 pAb (ATL-HPA047561)