Anti NKD1 pAb (ATL-HPA041352)

Atlas Antibodies

Catalog No.:
ATL-HPA041352-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: naked cuticle homolog 1 (Drosophila)
Gene Name: NKD1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031661: 81%, ENSRNOG00000014293: 78%
Entrez Gene ID: 85407
Uniprot ID: Q969G9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WARKGIEEWIGRQRCPGGVSGPRQLRLAGTIGRSTRELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCP
Gene Sequence WARKGIEEWIGRQRCPGGVSGPRQLRLAGTIGRSTRELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCP
Gene ID - Mouse ENSMUSG00000031661
Gene ID - Rat ENSRNOG00000014293
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti NKD1 pAb (ATL-HPA041352)
Datasheet Anti NKD1 pAb (ATL-HPA041352) Datasheet (External Link)
Vendor Page Anti NKD1 pAb (ATL-HPA041352) at Atlas Antibodies

Documents & Links for Anti NKD1 pAb (ATL-HPA041352)
Datasheet Anti NKD1 pAb (ATL-HPA041352) Datasheet (External Link)
Vendor Page Anti NKD1 pAb (ATL-HPA041352)