Anti NIM1K pAb (ATL-HPA007695)

Atlas Antibodies

Catalog No.: ATL-HPA007695-25

Protein Description: NIM1 serine/threonine protein kinase
Gene Name: NIM1K
Alternative Gene Name: MGC42105, NIM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000095930: 93%, ENSRNOG00000016353: 93%
Entrez Gene ID: 167359
Uniprot ID: Q8IY84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RDSVESGCQTESSKEGEEGQPRQLTPFEKLTQDMSQDEKVVREITLGKRIGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRLLSREISSMEKLHHPNIIRLYEVVETL
• Gene Sequence: RDSVESGCQTESSKEGEEGQPRQLTPFEKLTQDMSQDEKVVREITLGKRIGFYRIRGEIGSGNFSQVKLGIHSLTKEKVAIKILDKTKLDQKTQRLLSREISSMEKLHHPNIIRLYEVVETL
• Gene ID - Mouse: ENSMUSG00000095930
• Gene ID - Rat: ENSRNOG00000016353
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.