Anti NHEJ1 pAb (ATL-HPA043869)

Atlas Antibodies

Catalog No.: ATL-HPA043869-25

Protein Description: nonhomologous end-joining factor 1
Gene Name: NHEJ1
Alternative Gene Name: Cernunnos, FLJ12610, XLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026162: 57%, ENSRNOG00000018162: 67%
Entrez Gene ID: 79840
Uniprot ID: Q9H9Q4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, ChIP
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSA
• Gene Sequence: FLEQFMIEKLPEACSIGDGKPFVMNLQDLYMAVTTQEVQVGQKHQGAGDPHTSNSASLQGIDSQCVNQPEQLVSSA
• Gene ID - Mouse: ENSMUSG00000026162
• Gene ID - Rat: ENSRNOG00000018162
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.