Anti NGLY1 pAb (ATL-HPA036825)

Atlas Antibodies

Catalog No.: ATL-HPA036825-25

Protein Description: N-glycanase 1
Gene Name: NGLY1
Alternative Gene Name: FLJ11005, PNG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021785: 87%, ENSRNOG00000006143: 87%
Entrez Gene ID: 55768
Uniprot ID: Q96IV0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ISDEDFLLLELLHWFKEEFFHWVNNVLCSKCGGQTRSRDRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGR
• Gene Sequence: ISDEDFLLLELLHWFKEEFFHWVNNVLCSKCGGQTRSRDRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEKLLETRCGR
• Gene ID - Mouse: ENSMUSG00000021785
• Gene ID - Rat: ENSRNOG00000006143
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NGLY1 pAb (ATL-HPA036825) – 11 Found

He, Ping; Grotzke, Jeff E; Ng, Bobby G; Gunel, Murat; Jafar-Nejad, Hamed; Cresswell, Peter; Enns, Gregory M; Freeze, Hudson H. A congenital disorder of deglycosylation: Biochemical characterization of N-glycanase 1 deficiency in patient fibroblasts. Glycobiology. 2015;25(8):836-44. 

Galeone, Antonio; Han, Seung Yeop; Huang, Chengcheng; Hosomi, Akira; Suzuki, Tadashi; Jafar-Nejad, Hamed. Tissue-specific regulation of BMP signaling by Drosophila N-glycanase 1. Elife. 2017;6( 28826503) 

Mueller, William F; Zhu, Lei; Tan, Brandon; Dwight, Selina; Beahm, Brendan; Wilsey, Matt; Wechsler, Thomas; Mak, Justin; Cowan, Tina; Pritchett, Jake; Taylor, Eric; Crawford, Brett E. GlcNAc-Asn is a biomarker for NGLY1 deficiency. Journal Of Biochemistry. 2022;171(2):177-186. 

Forcina, Giovanni C; Pope, Lauren; Murray, Magdalena; Dong, Wentao; Abu-Remaileh, Monther; Bertozzi, Carolyn R; Dixon, Scott J. Ferroptosis regulation by the NGLY1/NFE2L1 pathway. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2022;119(11):e2118646119. 

Asahina, Makoto; Fujinawa, Reiko; Nakamura, Sayuri; Yokoyama, Kotaro; Tozawa, Ryuichi; Suzuki, Tadashi. Ngly1 -/- rats develop neurodegenerative phenotypes and pathological abnormalities in their peripheral and central nervous systems. Human Molecular Genetics. 2020;29(10):1635-1647. 

Mueller, William F; Jakob, Petra; Sun, Han; Clauder-Münster, Sandra; Ghidelli-Disse, Sonja; Ordonez, Diana; Boesche, Markus; Bantscheff, Marcus; Collier, Paul; Haase, Bettina; Benes, Vladimir; Paulsen, Malte; Sehr, Peter; Lewis, Joe; Drewes, Gerard; Steinmetz, Lars M. Loss of N-Glycanase 1 Alters Transcriptional and Translational Regulation in K562 Cell Lines. G3 (Bethesda, Md.). 2020;10(5):1585-1597. 

Galeone, Antonio; Adams, Joshua M; Matsuda, Shinya; Presa, Maximiliano F; Pandey, Ashutosh; Han, Seung Yeop; Tachida, Yuriko; Hirayama, Hiroto; Vaccari, Thomas; Suzuki, Tadashi; Lutz, Cathleen M; Affolter, Markus; Zuberi, Aamir; Jafar-Nejad, Hamed. Regulation of BMP4/Dpp retrotranslocation and signaling by deglycosylation. Elife. 2020;9( 32720893) 

Asahina, Makoto; Fujinawa, Reiko; Fujihira, Haruhiko; Masahara-Negishi, Yuki; Andou, Tomohiro; Tozawa, Ryuichi; Suzuki, Tadashi. JF1/B6F1 Ngly1(-/-) mouse as an isogenic animal model of NGLY1 deficiency. Proceedings Of The Japan Academy. Series B, Physical And Biological Sciences. 97(2):89-102. 

Asahina, Makoto; Fujinawa, Reiko; Hirayama, Hiroto; Tozawa, Ryuichi; Kajii, Yasushi; Suzuki, Tadashi. Reversibility of motor dysfunction in the rat model of NGLY1 deficiency. Molecular Brain. 2021;14(1):91. 

Mesika, Aviv; Nadav, Golan; Shochat, Chen; Kalfon, Limor; Jackson, Karen; Khalaileh, Ayat; Karasik, David; Falik-Zaccai, Tzipora C. NGLY1 Deficiency Zebrafish Model Manifests Abnormalities of the Nervous and Musculoskeletal Systems. Frontiers In Cell And Developmental Biology. 10( 35769264):902969. 

Zhu, Lei; Tan, Brandon; Dwight, Selina S; Beahm, Brendan; Wilsey, Matt; Crawford, Brett E; Schweighardt, Becky; Cook, Jennifer W; Wechsler, Thomas; Mueller, William F. AAV9-NGLY1 gene replacement therapy improves phenotypic and biomarker endpoints in a rat model of NGLY1 Deficiency. Molecular Therapy. Methods & Clinical Development. 2022;27( 36320418):259-271.