Anti NFU1 pAb (ATL-HPA035826)

Atlas Antibodies

Catalog No.: ATL-HPA035826-25

Protein Description: NFU1 iron-sulfur cluster scaffold
Gene Name: NFU1
Alternative Gene Name: CGI-33, HIRIP5, NifU, NIFUC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029993: 96%, ENSRNOG00000018410: 99%
Entrez Gene ID: 27247
Uniprot ID: Q9UMS0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDD
• Gene Sequence: PAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEELDWNLLKPDIYATIMDFFASGLPLVTEETPSGEAGSEEDD
• Gene ID - Mouse: ENSMUSG00000029993
• Gene ID - Rat: ENSRNOG00000018410
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.