Anti NFIX pAb (ATL-HPA007533)

Atlas Antibodies

Catalog No.: ATL-HPA007533-25

Protein Description: nuclear factor I/X (CCAAT-binding transcription factor)
Gene Name: NFIX
Alternative Gene Name: NF1A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001911: 99%, ENSRNOG00000002983: 78%
Entrez Gene ID: 4784
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC, ChIP-Exo-Seq
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQHSQRQAPPLPTGLSASD
• Gene Sequence: SPSYYNINQVTLGRRSITSPPSTSTTKRPKSIDDSEMESPVDDVFYPGTGRSPAAGSSQSSGWPNDVDAGSPRATASALHFPSTSIIQQSSPYFTHPTIRYHHHHGQDSLKEFVQFVCSDGSGQATGQHSQRQAPPLPTGLSASD
• Gene ID - Mouse: ENSMUSG00000001911
• Gene ID - Rat: ENSRNOG00000002983
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti NFIX pAb (ATL-HPA007533) – 1 Found

Kleemann, Michael; Schneider, Helga; Unger, Kristian; Sander, Philip; Schneider, E Marion; Fischer-Posovszky, Pamela; Handrick, René; Otte, Kerstin. MiR-744-5p inducing cell death by directly targeting HNRNPC and NFIX in ovarian cancer cells. Scientific Reports. 2018;8(1):9020.