Anti NFATC4 pAb (ATL-HPA031641)
Atlas Antibodies
- Catalog No.:
- ATL-HPA031641-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: NFATC4
Alternative Gene Name: NFAT3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023411: 91%, ENSRNOG00000020482: 93%
Entrez Gene ID: 4776
Uniprot ID: Q14934
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDFSPPRPPYPSYPHEDPAC |
| Gene Sequence | SACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDFSPPRPPYPSYPHEDPAC |
| Gene ID - Mouse | ENSMUSG00000023411 |
| Gene ID - Rat | ENSRNOG00000020482 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti NFATC4 pAb (ATL-HPA031641) | |
| Datasheet | Anti NFATC4 pAb (ATL-HPA031641) Datasheet (External Link) |
| Vendor Page | Anti NFATC4 pAb (ATL-HPA031641) at Atlas Antibodies |
| Documents & Links for Anti NFATC4 pAb (ATL-HPA031641) | |
| Datasheet | Anti NFATC4 pAb (ATL-HPA031641) Datasheet (External Link) |
| Vendor Page | Anti NFATC4 pAb (ATL-HPA031641) |
| Citations for Anti NFATC4 pAb (ATL-HPA031641) – 1 Found |
| Peuker, Kenneth; Muff, Stefanie; Wang, Jun; Künzel, Sven; Bosse, Esther; Zeissig, Yvonne; Luzzi, Giuseppina; Basic, Marijana; Strigli, Anne; Ulbricht, Andrea; Kaser, Arthur; Arlt, Alexander; Chavakis, Triantafyllos; van den Brink, Gijs R; Schafmayer, Clemens; Egberts, Jan-Hendrik; Becker, Thomas; Bianchi, Marco E; Bleich, André; Röcken, Christoph; Hampe, Jochen; Schreiber, Stefan; Baines, John F; Blumberg, Richard S; Zeissig, Sebastian. Epithelial calcineurin controls microbiota-dependent intestinal tumor development. Nature Medicine. 2016;22(5):506-15. PubMed |